Glucagon antibody (N-Term)
-
- Target See all Glucagon (GCG) Antibodies
- Glucagon (GCG)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glucagon antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Glucagon antibody was raised against the N terminal of GCG
- Purification
- Purified
- Immunogen
- Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
- Top Product
- Discover our top product GCG Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Glucagon Blocking Peptide, catalog no. 33R-5415, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucagon (GCG)
- Alternative Name
- Glucagon (GCG Products)
- Synonyms
- GLP1 antibody, GLP2 antibody, GRPP antibody, GLP-1 antibody, Glu antibody, PPG antibody, GCG antibody, gcg-A antibody, gcg1 antibody, glucagon antibody, glucagon L homeolog antibody, GCG antibody, Gcg antibody, gcg.L antibody
- Background
- GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling
-