TYR antibody

Catalog No. ABIN630459

Product Details anti-TYR Antibody

Target: TYR (Tyrosinase (TYR))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TYR antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TYR Blocking Peptide, catalog no. 33R-1745, is also available for use as a blocking control in assays to test for specificity of this TYR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TYR

Target: TYR (Tyrosinase (TYR))

Alternative Name: TYR (TYR Products)

Synonyms: sandy antibody, zgc:109705 antibody, TYR antibody, TYRO antibody, tyr antibody, LOC100136546 antibody, CMM8 antibody, OCA1A antibody, OCAIA antibody, SHEP3 antibody, albino antibody, c antibody, skc35 antibody, C antibody, tyrosinase antibody, TYRosinase antibody, tyrosinase S homeolog antibody, tyr antibody, tyr-5 antibody, tyr.S antibody, TYR antibody, Celal_3121 antibody, Halhy_4121 antibody, Mesop_2736 antibody, LOC100136546 antibody, Tyr antibody

Background: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Molecular Weight: 58 kDa (MW of target protein)