Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) antibody
| Antigen | Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) |
| Synonyms | SMPR, MPR46, CD-MPR, FLJ32994, CD222, CI-MPR, Mpr300, AI661837, M6P/IGF2R, M6PR, CDMPR, MGC140730, MGC94300, m6pr, MGC68896, MGC130765, zgc:77757, wu:fj81h11, MGC89423, mprd |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN630460 |
| Quantity | 100 ug (1 mg/ml) |
| Price | 410.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | M6PR |
| Immunogen | M6PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE |
| Description | M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane. |
| Molecular Weight | 28 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Total IgG Protein A purified |
| Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of M6PR antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR)", type "Antibodies"
| Hosts | Rabbit (6), Goat (3), Mouse (2), Sheep (2), Chicken (1) |
| Reactivities | Human (6), Cow (Bovine) (1) |
| Applications | Western Blotting (WB) (10), Immunohistochemistry (IHC) (8), ELISA (3), Enzyme Immunoassay (EIA) (3), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1) |
| Epitopes | internal (5), N-Term (2) |
