M6PR antibody (Mannose-6-Phosphate Receptor (Cation Dependent)) (AA 211-277)

Details for Product anti-M6PR Antibody No. ABIN561704
Antigen
  • CD-MPR
  • MPR 46
  • MPR-46
  • MPR46
  • SMPR
  • Mpr46
  • CDMPR
  • m6pr
  • MGC68896
  • MGC130765
  • zgc:77757
  • wu:fj81h11
  • MGC89423
  • M6PR
  • mprd
  • mannose-6-phosphate receptor, cation dependent
  • mannose-6-phosphate receptor (cation dependent) L homeolog
  • mannose-6-phosphate receptor (cation dependent)
  • mannose-6-phosphate receptor (cation dependent) S homeolog
  • Cation-dependent mannose-6-phosphate receptor
  • M6PR
  • M6pr
  • m6pr.L
  • m6pr
  • m6pr.S
  • Ethha_1678
  • mprd
Epitope
AA 211-277
15
5
4
3
2
2
1
1
1
1
Reactivity
Human
65
25
21
4
3
2
2
1
1
Host
Mouse
55
7
6
3
3
Clonality
Polyclonal
Conjugate
This M6PR antibody is un-conjugated
7
5
5
2
2
2
2
2
2
1
1
1
Application
ELISA, Western Blotting (WB)
50
31
24
4
4
3
3
3
3
2
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant M6PR.
Immunogen

immunogen: M6PR (NP_002346, 211 a.a. ~ 277 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others M6PR products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name M6PR (M6PR Antibody Abstract)
Background Full Gene Name: mannose-6-phosphate receptor (cation dependent)
Synonyms: CD-MPR,FLJ32994,MPR46,SMPR
Gene ID 4074
NCBI Accession NP_002346, NM_002355
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR) (AA 211-277) antibody (ABIN561704) Western Blot detection against Immunogen (33.48 KDa) .
Product cited in: Steffan, Williams, Welbourne, Cardelli: "HGF-induced invasion by prostate tumor cells requires anterograde lysosome trafficking and activity of Na+-H+ exchangers." in: Journal of cell science, Vol. 123, Issue Pt 7, pp. 1151-9, 2010 (PubMed).

Kinzel, Boldt, Davis, Burtscher, Trümbach, Diplas, Attié-Bitach, Wurst, Katsanis, Ueffing, Lickert: "Pitchfork regulates primary cilia disassembly and left-right asymmetry." in: Developmental cell, Vol. 19, Issue 1, pp. 66-77, 2010 (PubMed).

Did you look for something else?