Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Solute Carrier Family 13 Member 3 (SLC13A3) antibody

Antigen

Solute Carrier Family 13 Member 3 (SLC13A3)

Synonyms NADC3, SDCT2, NaDC3, NaDC-3, MGC81935, SLC13A3, MGC108337, Nadc3, MGC77173, zgc:77173, MGC140507
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630477
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SLC13A3
Immunogen SLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL
Description Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.
Molecular Weight 66 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC13A3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Solute Carrier Family 13 Member 3 (SLC13A3)", type "Antibodies"
Hosts Rabbit (4), Mouse (3)
Reactivities Human (5)
Applications Western Blotting (WB) (7), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (IHC) (2), ELISA (Detection) (1)