DYRK1A antibody
-
- Target See all DYRK1A Antibodies
- DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DYRK1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DYRK1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM
- Top Product
- Discover our top product DYRK1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DYRK1A Blocking Peptide, catalog no. 33R-4071, is also available for use as a blocking control in assays to test for specificity of this DYRK1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYRK0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))
- Alternative Name
- DYRK1A (DYRK1A Products)
- Synonyms
- DYRK1A antibody, dyrk antibody, dyrk1 antibody, hp86 antibody, mnb antibody, mnbh antibody, DYRK antibody, DYRK1 antibody, HP86 antibody, MNB antibody, MNBH antibody, MRD7 antibody, 2310043O08Rik antibody, D16Ertd272e antibody, D16Ertd493e antibody, Dyrk antibody, ENSMUSG00000074897 antibody, Gm10783 antibody, Mnbh antibody, Mp86 antibody, mmb antibody, PSK47 antibody, dual specificity tyrosine phosphorylation regulated kinase 1A antibody, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a antibody, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A S homeolog antibody, DYRK1A antibody, dyrk1a antibody, Dyrk1a antibody, dyrk1a.S antibody
- Background
- This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development.
- Molecular Weight
- 85 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-