HORMAD2 antibody (Middle Region)

Catalog No. ABIN630566

Product Details anti-HORMAD2 Antibody

Target: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HORMAD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HORMAD2 antibody was raised against the middle region of HORMAD2

Purification: Affinity purified

Immunogen: HORMAD2 antibody was raised using the middle region of HORMAD2 corresponding to a region with amino acids YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HORMAD2 Blocking Peptide, catalog no. 33R-10259, is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HORMAD2

Target: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Alternative Name: HORMAD2 (HORMAD2 Products)

Synonyms: 4930529M09Rik antibody, HORMA domain containing 2 antibody, HORMAD2 antibody, Hormad2 antibody

Background: The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)