HNF4A antibody (Middle Region)
-
- Target See all HNF4A Antibodies
- HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNF4A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNF4 A antibody was raised against the middle region of HNF4
- Purification
- Affinity purified
- Immunogen
- HNF4 A antibody was raised using the middle region of HNF4 corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI
- Top Product
- Discover our top product HNF4A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNF4A Blocking Peptide, catalog no. 33R-5264, is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))
- Alternative Name
- HNF4A (HNF4A Products)
- Synonyms
- HNF4A antibody, HNF4alpha antibody, CG9310 antibody, DmHNF4 antibody, Dmel\\CG9310 antibody, HNF-4 antibody, HNF-4(D) antibody, HNF4 antibody, Hnf-4 antibody, Hnf-4h antibody, NR2A4 antibody, dHNF-4 antibody, dHNF4 antibody, Hnf4 antibody, Hnf4alpha antibody, MODY1 antibody, Nr2a1 antibody, Tcf14 antibody, HNF4a7 antibody, HNF4a8 antibody, HNF4a9 antibody, MODY antibody, NR2A1 antibody, NR2A21 antibody, TCF antibody, TCF14 antibody, HNF-4alpha antibody, fb58h09 antibody, id:ibd1279 antibody, wu:fb58h09 antibody, hnf4 antibody, nr2a1 antibody, hepatocyte nuclear factor 4 alpha antibody, Hepatocyte nuclear factor 4 antibody, hepatic nuclear factor 4, alpha antibody, hepatocyte nuclear factor 4, alpha antibody, hepatocyte nuclear factor 4 alpha S homeolog antibody, HNF4A antibody, hnf4a antibody, Hnf4 antibody, Hnf4a antibody, hnf4a.S antibody
- Background
- The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process
-