PIWIL4 antibody
-
- Target See all PIWIL4 Antibodies
- PIWIL4 (Piwi-Like 4 (PIWIL4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIWIL4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
- Top Product
- Discover our top product PIWIL4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIWIL4 Blocking Peptide, catalog no. 33R-5441, is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIWIL4 (Piwi-Like 4 (PIWIL4))
- Alternative Name
- PIWIL4 (PIWIL4 Products)
- Synonyms
- HIWI2 antibody, MIWI2 antibody, 9230101H05Rik antibody, Miwi2 antibody, piwi like RNA-mediated gene silencing 4 antibody, piwi-like RNA-mediated gene silencing 4 antibody, PIWIL4 antibody, Piwil4 antibody
- Background
- PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
- Molecular Weight
- 96 kDa (MW of target protein)
-