GAPDH antibody (Middle Region)

Catalog No. ABIN630875

Product Details anti-GAPDH Antibody

Target: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAPDH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GAPDH antibody was raised against the middle region of GAPDH

Purification: Affinity purified

Immunogen: GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAPDH Blocking Peptide, catalog no. 33R-4239, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-GAPDH antibody (ABIN630875)

Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." in: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

Target Details for GAPDH

Target: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Alternative Name: GAPDH (GAPDH Products)

Synonyms: G3PD antibody, GAPD antibody, Gapd antibody, BEST:GH12586 antibody, CG12055 antibody, Dmel\\CG12055 antibody, GA3PDH antibody, GADPH antibody, GAP antibody, GAPDH antibody, GAPDH I antibody, GAPDH-1 antibody, GAPDH1 antibody, GAPDHI antibody, Gapdh antibody, Gapdh-1 antibody, Gapdh43E antibody, gadph antibody, gapdh antibody, gapdh-1 antibody, gh12586 antibody, cb609 antibody, gapd antibody, mg:bb02e05 antibody, wu:fb33a10 antibody, wu:ft80f05 antibody, KNC-NDS6 antibody, g3pd antibody, G3PDH antibody, glyceraldehyde-3-phosphate dehydrogenase antibody, Glyceraldehyde 3 phosphate dehydrogenase 1 antibody, glyceraldehyde-3-phosphate dehydrogenase S homeolog antibody, glyceraldehyde-3-phosphate dehydrogenase, type I antibody, olfactory receptor 8K3 antibody, GAPDH antibody, Gapdh antibody, Gapdh1 antibody, gapdh antibody, gapdh.S antibody, gapDH antibody, LOC100404960 antibody, LOC614985 antibody

Background: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

Molecular Weight: 36 kDa (MW of target protein)