MEMO1 antibody (Middle Region)
-
- Target See all MEMO1 Antibodies
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MEMO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MEMO1 antibody was raised against the middle region of MEMO1
- Purification
- Affinity purified
- Immunogen
- MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH
- Top Product
- Discover our top product MEMO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
- Alternative Name
- MEMO1 (MEMO1 Products)
- Synonyms
- MGC89105 antibody, C2orf4 antibody, MEMO antibody, NS5ATP7 antibody, 0610016J10Rik antibody, D930048L02Rik antibody, RGD1309929 antibody, fi04d12 antibody, wu:fi04d12 antibody, zgc:55290 antibody, mediator of cell motility 1 antibody, mediator of cell motility 1 L homeolog antibody, MEMO1 antibody, memo1 antibody, Memo1 antibody, memo1.L antibody
- Background
- MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.
- Molecular Weight
- 34 kDa (MW of target protein)
-