Adenylate Kinase 1 antibody (Middle Region)
-
- Target See all Adenylate Kinase 1 (AK1) Antibodies
- Adenylate Kinase 1 (AK1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Adenylate Kinase 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AK1 antibody was raised against the middle region of AK1
- Purification
- Affinity purified
- Immunogen
- AK1 antibody was raised using the middle region of AK1 corresponding to a region with amino acids RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT
- Top Product
- Discover our top product AK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AK1 Blocking Peptide, catalog no. 33R-7966, is also available for use as a blocking control in assays to test for specificity of this AK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 1 (AK1)
- Alternative Name
- AK1 (AK1 Products)
- Synonyms
- ADK-1 antibody, AK1 antibody, CG17146 antibody, DAK1 antibody, Dak1 antibody, Dmel\\CG17146 antibody, adk1 antibody, bs34e10.y1 antibody, ak5 antibody, ADENYLATE KINASE 1 antibody, MLE2.3 antibody, MLE2_3 antibody, adenylate kinase 1 antibody, Ak-1 antibody, B430205N08Rik antibody, Ak 1 antibody, zgc:91930 antibody, Myokinase antibody, Adenylate kinase 1 antibody, adenylate kinase 1 antibody, Adk1 antibody, ak1 antibody, AK1 antibody, ADK1 antibody, Ak1 antibody
- Background
- Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-