OXSM antibody (Middle Region)
-
- Target See all OXSM Antibodies
- OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OXSM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OXSM antibody was raised against the middle region of OXSM
- Purification
- Affinity purified
- Immunogen
- OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
- Top Product
- Discover our top product OXSM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))
- Alternative Name
- OXSM (OXSM Products)
- Synonyms
- FASN2D antibody, KASI antibody, KS antibody, 4933425A18Rik antibody, C80494 antibody, RGD1311092 antibody, fatty acid synthase antibody, 3-oxoacyl-ACP synthase, mitochondrial antibody, FASN antibody, OXSM antibody, oxsm antibody, Oxsm antibody
- Background
- OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.
- Molecular Weight
- 49 kDa (MW of target protein)
-