PDK3 antibody (Middle Region)

Catalog No. ABIN631033

Product Details anti-PDK3 Antibody

Target: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDK3 antibody was raised against the middle region of PDK3

Purification: Affinity purified

Immunogen: PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDK3

Target: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Alternative Name: PDK3 (PDK3 Products)

Synonyms: pdk3 antibody, PDK3 antibody, 2610001M10Rik antibody, AI035637 antibody, zgc:158702 antibody, pyruvate dehydrogenase kinase 3 antibody, pyruvate dehydrogenase kinase, isozyme 3a antibody, pyruvate dehydrogenase kinase, isoenzyme 3 antibody, fragile site, 5-azacytidine type, common, fra(1)(q12) antibody, pyruvate dehydrogenase kinase, isozyme 3b antibody, PDK3 antibody, Pdk3 antibody, pdk3a antibody, pdk3 antibody, FRA1J antibody, pdk3b antibody

Background: PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect