IDH1 antibody
-
- Target See all IDH1 Antibodies
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IDH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
- Top Product
- Discover our top product IDH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IDH1 Blocking Peptide, catalog no. 33R-9808, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
- Alternative Name
- IDH1 (IDH1 Products)
- Synonyms
- IDCD antibody, IDH antibody, IDP antibody, IDPC antibody, PICD antibody, NADP-CICDH antibody, AI314845 antibody, AI788952 antibody, E030024J03Rik antibody, Id-1 antibody, Idh-1 antibody, Idpc antibody, cb876 antibody, fm90e09 antibody, im:7143416 antibody, wu:fm90e09 antibody, F23E12.180 antibody, F23E12_180 antibody, IDH-I antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antibody, isocitrate dehydrogenase 1 antibody, isocitrate dehydrogenase I antibody, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antibody, isocitrate dehydrogenase 1 (NADP+), soluble antibody, isocitrate dehydrogenase 1 (NADP+) L homeolog antibody, isocitrate dehydrogenase 1 antibody, IDH1 antibody, Idh1 antibody, idh1.L antibody, idh1 antibody
- Background
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Warburg Effect
-