IDH1 antibody (C-Term)
-
- Target See all IDH1 Antibodies
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
-
Binding Specificity
- AA 381-413, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IDH1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
- Sequence
- KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
Gene Name: isocitrate dehydrogenase 1 (NADP+), soluble
Protein Name: Isocitrate dehydrogenase [NADP] cytoplasmic - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product IDH1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).
: "
-
lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).
-
- Target
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
- Alternative Name
- IDH1 (IDH1 Products)
- Synonyms
- IDCD antibody, IDH antibody, IDP antibody, IDPC antibody, PICD antibody, NADP-CICDH antibody, AI314845 antibody, AI788952 antibody, E030024J03Rik antibody, Id-1 antibody, Idh-1 antibody, Idpc antibody, cb876 antibody, fm90e09 antibody, im:7143416 antibody, wu:fm90e09 antibody, F23E12.180 antibody, F23E12_180 antibody, IDH-I antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antibody, isocitrate dehydrogenase 1 antibody, isocitrate dehydrogenase I antibody, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antibody, isocitrate dehydrogenase 1 (NADP+), soluble antibody, isocitrate dehydrogenase 1 (NADP+) L homeolog antibody, isocitrate dehydrogenase 1 antibody, IDH1 antibody, Idh1 antibody, idh1.L antibody, idh1 antibody
- Background
-
Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Synonyms: Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody - Gene ID
- 3417
- UniProt
- O75874
- Pathways
- Warburg Effect
-