FBXO31 antibody (Middle Region)
-
- Target See all FBXO31 Antibodies
- FBXO31 (F-Box Protein 31 (FBXO31))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO31 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO31 antibody was raised against the middle region of FBXO31
- Purification
- Affinity purified
- Immunogen
- FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS
- Top Product
- Discover our top product FBXO31 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO31 (F-Box Protein 31 (FBXO31))
- Alternative Name
- FBXO31 (FBXO31 Products)
- Synonyms
- 1110003O08Rik antibody, 2310046N15Rik antibody, Fbx14 antibody, Fbxo14 antibody, FBX14 antibody, FBXO14 antibody, Fbx31 antibody, pp2386 antibody, RGD1561069 antibody, fbx14 antibody, fbx31 antibody, fbxo14 antibody, fbxo31 antibody, F-box protein 31 antibody, F-box protein 31 S homeolog antibody, F-box protein 31 L homeolog antibody, Fbxo31 antibody, FBXO31 antibody, fbxo31 antibody, fbxo31.S antibody, fbxo31.L antibody
- Background
- FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.
- Molecular Weight
- 40 kDa (MW of target protein)
-