TTL antibody (Middle Region)
-
- Target See all TTL Antibodies
- TTL (Tubulin tyrosine Ligase (TTL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TTL antibody was raised against the middle region of TTL
- Purification
- Affinity purified
- Immunogen
- TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF
- Top Product
- Discover our top product TTL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTL Blocking Peptide, catalog no. 33R-5571, is also available for use as a blocking control in assays to test for specificity of this TTL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTL (Tubulin tyrosine Ligase (TTL))
- Alternative Name
- TTL (TTL Products)
- Synonyms
- 2410003M22Rik antibody, 2700049H19Rik antibody, AI848570 antibody, wu:fb93a09 antibody, zgc:153332 antibody, tubulin tyrosine ligase antibody, Ttl antibody, TTL antibody, ttl antibody
- Background
- TTL catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-