PPM1B antibody

Catalog No. ABIN631255

Product Details anti-PPM1B Antibody

Target: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPM1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPM1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPM1B Blocking Peptide, catalog no. 33R-2480, is also available for use as a blocking control in assays to test for specificity of this PPM1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPM1B

Target: PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))

Alternative Name: PPM1B (PPM1B Products)

Synonyms: PP2C-beta-X antibody, PP2CB antibody, PP2CBETA antibody, PPC2BETAX antibody, Pp2c2 antibody, fc18g04 antibody, ppm1a antibody, wu:fc18g04 antibody, zgc:92329 antibody, pp2c-beta-x antibody, pp2cb antibody, pp2cbeta antibody, ppc2betax antibody, zgc:92031 antibody, protein phosphatase, Mg2+/Mn2+ dependent 1B antibody, protein phosphatase 1B, magnesium dependent, beta isoform antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1B antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Bb antibody, protein phosphatase, Mg2+/Mn2+ dependent 1B L homeolog antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Ba antibody, PPM1B antibody, Ppm1b antibody, ppm1bb antibody, ppm1b.L antibody, ppm1ba antibody

Background: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Molecular Weight: 21 kDa (MW of target protein)