UBE2K antibody
-
- Target See all UBE2K Antibodies
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UBE2 K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET
- Top Product
- Discover our top product UBE2K Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2K Blocking Peptide, catalog no. 33R-7744, is also available for use as a blocking control in assays to test for specificity of this UBE2K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
- Alternative Name
- UBE2K (UBE2K Products)
- Synonyms
- E2-25K antibody, HIP2 antibody, HYPG antibody, LIG antibody, UBC1 antibody, E2-25k antibody, Hip2 antibody, Hypg antibody, Lig antibody, e2-25k antibody, hip2 antibody, hypg antibody, lig antibody, AW492011 antibody, D5Ertd601e antibody, ube2k antibody, zgc:103472 antibody, zgc:110791 antibody, ubiquitin conjugating enzyme E2 K antibody, ubiquitin-conjugating enzyme E2K antibody, ubiquitin conjugating enzyme E2 K S homeolog antibody, ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) antibody, ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast) antibody, UBE2K antibody, Ube2k antibody, ube2k.S antibody, ube2k antibody, ube2kb antibody, ube2ka antibody
- Background
- UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.
- Molecular Weight
- 22 kDa (MW of target protein)
-