ATG4A antibody

Catalog No. ABIN631439

Product Details anti-ATG4A Antibody

Target: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG4A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ATG4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATG4A Blocking Peptide, catalog no. 33R-1853, is also available for use as a blocking control in assays to test for specificity of this ATG4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATG4A

Target: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Alternative Name: ATG4A (ATG4A Products)

Synonyms: apg4a antibody, autl2 antibody, F6E13.27 antibody, APG4A antibody, zgc:111958 antibody, Aut2a antibody, AUTL2 antibody, AI627006 antibody, AV169859 antibody, Apg4a antibody, Atg4al antibody, Autl2 antibody, Atg4a antibody, autophagy related 4A cysteine peptidase L homeolog antibody, autophagy related 4A cysteine peptidase antibody, Peptidase family C54 protein antibody, ATG4 autophagy related 4 homolog A (S. cerevisiae) antibody, autophagy related 4A, cysteine peptidase antibody, atg4a.L antibody, ATG4A antibody, AT2G44140 antibody, atg4a antibody, Atg4a antibody

Background: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Autophagy