PARP9 antibody
-
- Target See all PARP9 Antibodies
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARP9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI
- Top Product
- Discover our top product PARP9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARP9 Blocking Peptide, catalog no. 33R-5013, is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
- Alternative Name
- PARP9 (PARP9 Products)
- Synonyms
- RGD1307534 antibody, ARTD9 antibody, BAL antibody, BAL1 antibody, MGC:7868 antibody, AW214463 antibody, BC003281 antibody, Bagl antibody, Bal antibody, PARP-9 antibody, poly (ADP-ribose) polymerase family, member 9 antibody, poly(ADP-ribose) polymerase family member 9 antibody, si:ch211-219a4.6 antibody, Parp9 antibody, PARP9 antibody, si:ch211-219a4.6 antibody
- Background
- PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.
- Molecular Weight
- 96 kDa (MW of target protein)
-