SHMT1 antibody

Catalog No. ABIN631508

Product Details anti-SHMT1 Antibody

Target: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHMT1 Blocking Peptide, catalog no. 33R-6720, is also available for use as a blocking control in assays to test for specificity of this SHMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHMT1

Target: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Alternative Name: SHMT1 (SHMT1 Products)

Synonyms: Shmt antibody, mShmt antibody, LRRGT00032 antibody, shmt1 antibody, MGC53442 antibody, zgc:66171 antibody, zgc:77524 antibody, SHMT1 antibody, Shmt1 antibody, CSHMT antibody, SHMT antibody, AI324848 antibody, AI385541 antibody, C81125 antibody, mshmt antibody, mshmt1 antibody, mshmt2 antibody, MEL-32 antibody, SHMT2 antibody, F20D10.50 antibody, F20D10_50 antibody, SERINE HYDROXYMETHYLTRANSFERASE 1 antibody, SERINE TRANSHYDROXYMETHYLASE antibody, SERINE TRANSHYDROXYMETHYLTRANSFERASE antibody, STM antibody, serine transhydroxymethyltransferase 1 antibody, serine hydroxymethyltransferase 1 antibody, serine hydroxymethyltransferase 1 (soluble) L homeolog antibody, serine hydroxymethyltransferase 1 (soluble) antibody, microRNA 6778 antibody, serine transhydroxymethyltransferase 1 antibody, Shmt1 antibody, shmt1.L antibody, shmt1 antibody, MIR6778 antibody, SHMT1 antibody, SHM1 antibody

Background: This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Molecular Weight: 53 kDa (MW of target protein)