NEXN antibody
-
- Target See all NEXN Antibodies
- NEXN (Nexilin (NEXN))
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEXN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI
- Top Product
- Discover our top product NEXN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nexilin Blocking Peptide, catalog no. 33R-2372, is also available for use as a blocking control in assays to test for specificity of this Nexilin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEXN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEXN (Nexilin (NEXN))
- Alternative Name
- Nexilin (NEXN Products)
- Synonyms
- 1110046H09Rik antibody, AA553326 antibody, NELIN antibody, CMH20 antibody, nexilin antibody, nexilin F-actin binding protein antibody, nexilin F-actin binding protein S homeolog antibody, nexilin (F actin binding protein) antibody, LOC100422793 antibody, nexn antibody, Nexn antibody, nexn.S antibody, NEXN antibody
- Background
- NEXN is involved in regulating cell migration through association with the actin cytoskeleton.
- Molecular Weight
- 81 kDa (MW of target protein)
-