Acetyl-CoA Acyltransferase 1 (ACAA1) antibody

Antigen: Acetyl-CoA Acyltransferase 1 (ACAA1)

Synonyms: ACAA, THIO, PTHIO, PTL, Acaa, Acaa1, MGC7090, D9Ertd25e, MGC64556, zgc:92385, MGC128200, acaa, thio, pthio, MGC147499, T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN631524

Additional Information

Alternative name: ACAA1

Immunogen: ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Description: ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.

Molecular Weight: 44 kDa (MW of target protein)

Synonyms: ACAA, THIO, PTHIO, PTL, Acaa, Acaa1, MGC7090, D9Ertd25e, MGC64556, zgc:92385, MGC128200, acaa, thio, pthio, MGC147499, T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAA1 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Cancer, Fatty Acids, Metabolism, Organelles

Restrictions: For Research Use only