KPTN antibody
-
- Target See all KPTN Antibodies
- KPTN (Kaptin (Actin Binding Protein) (KPTN))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KPTN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL
- Top Product
- Discover our top product KPTN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Kaptin Blocking Peptide, catalog no. 33R-6017, is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KPTN (Kaptin (Actin Binding Protein) (KPTN))
- Alternative Name
- Kaptin (KPTN Products)
- Synonyms
- 2310042D10Rik antibody, 2E4 antibody, C030013F01Rik antibody, wu:fc13b08 antibody, wu:fc13b09 antibody, zgc:100793 antibody, kaptin, actin binding protein antibody, kaptin antibody, kaptin (actin binding protein) antibody, kaptin (actin binding protein) L homeolog antibody, kptn antibody, Kptn antibody, KPTN antibody, kptn.L antibody
- Background
- KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-