VPS8 antibody

Catalog No. ABIN631659

Product Details anti-VPS8 Antibody

Target: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS8 Blocking Peptide, catalog no. 33R-1696, is also available for use as a blocking control in assays to test for specificity of this VPS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS8

Target: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Alternative Name: VPS8 (VPS8 Products)

Synonyms: si:dkey-24b15.1 antibody, zgc:158695 antibody, KIAA0804 antibody, AI315068 antibody, AU040738 antibody, mKIAA0804 antibody, RGD1309443 antibody, VPS8, CORVET complex subunit antibody, vacuolar protein sorting 8 homolog (S. cerevisiae) antibody, VPS8 CORVET complex subunit antibody, vps8 antibody, VPS8 antibody, Vps8 antibody

Background: VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.

Molecular Weight: 162 kDa (MW of target protein)