SKA3 antibody (Middle Region)
-
- Target See all SKA3 Antibodies
- SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SKA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SKA3 antibody was raised against the middle region of SKA3
- Purification
- Affinity purified
- Immunogen
- SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL
- Top Product
- Discover our top product SKA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))
- Alternative Name
- SKA3 (SKA3 Products)
- Synonyms
- C13orf3 antibody, RAMA1 antibody, RGD1307201 antibody, C12H13ORF3 antibody, fc23d11 antibody, si:rp71-68n21.13 antibody, wu:fc23d11 antibody, rama1 antibody, F630043A04Rik antibody, spindle and kinetochore associated complex subunit 3 antibody, spindle and kinetochore associated complex subunit 3 L homeolog antibody, SKA3 antibody, Ska3 antibody, ska3 antibody, ska3.L antibody
- Background
- This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 46 kDa (MW of target protein)
-