PUS10 antibody (Middle Region)
-
- Target See all PUS10 Antibodies
- PUS10 (Pseudouridylate Synthase 10 (PUS10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PUS10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PUS10 antibody was raised against the middle region of PUS10
- Purification
- Affinity purified
- Immunogen
- PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
- Top Product
- Discover our top product PUS10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUS10 (Pseudouridylate Synthase 10 (PUS10))
- Alternative Name
- PUS10 (PUS10 Products)
- Synonyms
- CCDC139 antibody, DOBI antibody, 2810013G11Rik antibody, 4933435A13Rik antibody, AU014648 antibody, C77560 antibody, Ccdc139 antibody, RGD1306402 antibody, pseudouridylate synthase 10 antibody, PUS10 antibody, Pus10 antibody
- Background
- Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.
- Molecular Weight
- 60 kDa (MW of target protein)
-