Pellino 3 antibody
-
- Target See all Pellino 3 (PELI3) Antibodies
- Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Pellino 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
- Top Product
- Discover our top product PELI3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PELI3 Blocking Peptide, catalog no. 33R-9649, is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))
- Alternative Name
- PELI3 (PELI3 Products)
- Synonyms
- 6030441F14Rik antibody, A930011L17 antibody, BC028931 antibody, RGD1305989 antibody, pellino 3 antibody, pellino E3 ubiquitin protein ligase family member 3 antibody, Peli3 antibody, PELI3 antibody
- Background
- Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-