POLR1E antibody
-
- Target See all POLR1E Antibodies
- POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLR1E antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- POLR1 E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL
- Top Product
- Discover our top product POLR1E Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLR1E Blocking Peptide, catalog no. 33R-8675, is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))
- Alternative Name
- POLR1E (POLR1E Products)
- Synonyms
- 53kDa antibody, AU042259 antibody, D030019D19Rik antibody, Paf53 antibody, Praf1 antibody, PAF53 antibody, PRAF1 antibody, RP11-405L18.3 antibody, RNA polymerase I subunit E antibody, polymerase (RNA) I polypeptide E antibody, polymerase (RNA) I polypeptide E L homeolog antibody, POLR1E antibody, polr1e antibody, Polr1e antibody, polr1e.L antibody
- Background
- POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
- Molecular Weight
- 47 kDa (MW of target protein)
-