14-3-3 zeta antibody (Middle Region)
-
- Target See all 14-3-3 zeta (YWHAZ) Antibodies
- 14-3-3 zeta (YWHAZ)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This 14-3-3 zeta antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- YWHAZ antibody was raised against the middle region of Ywhaz
- Purification
- Affinity purified
- Immunogen
- YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
- Top Product
- Discover our top product YWHAZ Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- 14-3-3 zeta (YWHAZ)
- Alternative Name
- YWHAZ (YWHAZ Products)
- Synonyms
- 14-3-3-zeta antibody, KCIP-1 antibody, YWHAD antibody, 14-3-3zeta antibody, Ywhaz antibody, ACYPI003154 antibody, 14-3-3z antibody, kcip-1 antibody, ywhaq antibody, 1433z antibody, ywhaz antibody, ywhazb antibody, 1110013I11Rik antibody, AI596267 antibody, AL022924 antibody, AU020854 antibody, ywhaza antibody, fb14h09 antibody, wu:fb05g08 antibody, wu:fb14h09 antibody, ywhai antibody, zgc:55807 antibody, 14-3-3 antibody, 14-3-3 zeta antibody, 14-3-3ZETA antibody, 14-3-3leo antibody, 2G1 antibody, 4-3-3 zeta antibody, 5.11 antibody, 549 antibody, BEST:GH05075 antibody, CG17870 antibody, D14-3-3 antibody, D14-3-3zeta antibody, Dmel\\CG17870 antibody, K antibody, LEO antibody, Leo antibody, PAR-5 antibody, PAR5 antibody, Par-5 antibody, d14-3-3zeta antibody, l(2)07103 antibody, l(2)46CFe antibody, l(2)46Ee antibody, leo antibody, par-5 antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antibody, 14-3-3 protein zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antibody, 14-3-3 protein zeta/delta pseudogene antibody, CG17870 gene product from transcript CG17870-RE antibody, YWHAZ antibody, 14-3-3zeta antibody, ywhaz antibody, 1433z antibody, ywhaz.L antibody, Ywhaz antibody, ywhaz.S antibody, LOC100855903 antibody
- Background
- YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
-