Fgr antibody
-
- Target See all Fgr (FGR) Antibodies
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Fgr antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
- Top Product
- Discover our top product FGR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FGR Blocking Peptide, catalog no. 33R-1770, is also available for use as a blocking control in assays to test for specificity of this FGR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
- Alternative Name
- FGR (FGR Products)
- Synonyms
- SRC2 antibody, c-fgr antibody, c-src2 antibody, p55-Fgr antibody, p55c-fgr antibody, p58-Fgr antibody, p58c-fgr antibody, FGR proto-oncogene, Src family tyrosine kinase antibody, FGR antibody, Fgr antibody
- Background
- This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Stem Cell Maintenance, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-