BCKDK antibody (N-Term)

Catalog No. ABIN632248

Product Details anti-BCKDK Antibody

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCKDK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCKDK antibody was raised against the N terminal of BCKDK

Purification: Affinity purified

Immunogen: BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCKDK Blocking Peptide, catalog no. 33R-1742, is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCKDK

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Alternative Name: BCKDK (BCKDK Products)

Synonyms: cb233 antibody, zgc:55984 antibody, wu:fa04g07 antibody, wu:fb80b08 antibody, MGC78818 antibody, BCKDK antibody, AI327402 antibody, BCKDKD antibody, BDK antibody, branched chain ketoacid dehydrogenase kinase antibody, branched chain ketoacid dehydrogenase kinase S homeolog antibody, bckdk antibody, bckdk.S antibody, BCKDK antibody, Bckdk antibody

Background: BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome