DCTPP1 antibody (Middle Region)

Catalog No. ABIN632345

Product Details anti-DCTPP1 Antibody

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCTPP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: XTP3 TPA antibody was raised against the middle region of XTP3 PA

Purification: Affinity purified

Immunogen: XTP3 TPA antibody was raised using the middle region of XTP3 PA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XTP3TPA Blocking Peptide, catalog no. 33R-4552, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCTPP1

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Alternative Name: XTP3TPA (DCTPP1 Products)

Synonyms: RS21C6 antibody, XTP3TPA antibody, 2410015N17Rik antibody, AI854235 antibody, RS21-C6 antibody, Rs21c6 antibody, Xtp3tpa antibody, xtp3tpa antibody, dCTP pyrophosphatase 1 antibody, dCTP pyrophosphatase 1 L homeolog antibody, DCTPP1 antibody, Dctpp1 antibody, dctpp1.L antibody, dctpp1 antibody

Background: XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity and pyrimidine deoxyribonucleotide binding.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome