Amphiphysin antibody (N-Term)

Catalog No. ABIN632382

Product Details anti-Amphiphysin Antibody

Target: Amphiphysin (AMPH)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Amphiphysin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Amphiphysin antibody was raised against the N terminal of AMPH

Purification: Affinity purified

Immunogen: Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Amphiphysin Blocking Peptide, catalog no. 33R-1095, is also available for use as a blocking control in assays to test for specificity of this Amphiphysin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Amphiphysin

Target: Amphiphysin (AMPH)

Alternative Name: Amphiphysin (AMPH Products)

Synonyms: Amp antibody, CG8604 antibody, DAMP antibody, Damp antibody, Dmel\\CG8604 antibody, amph antibody, dAmph antibody, damph antibody, AMPH antibody, Amph antibody, GB16263 antibody, AMPH1 antibody, Amph1 antibody, wu:fq25h04 antibody, zgc:73193 antibody, amphiphysin antibody, Amphiphysin antibody, amphiphysin L homeolog antibody, AMPH antibody, Amph antibody, amph antibody, LOC409851 antibody, amph.L antibody, LOC100343468 antibody

Background: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.

Molecular Weight: 76 kDa (MW of target protein)