TRAPPC1 antibody (Middle Region)
-
- Target See all TRAPPC1 Antibodies
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRAPPC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRAPPC1 antibody was raised against the middle region of TRAPPC1
- Purification
- Affinity purified
- Immunogen
- TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM
- Top Product
- Discover our top product TRAPPC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
- Alternative Name
- TRAPPC1 (TRAPPC1 Products)
- Synonyms
- BET5 antibody, MUM2 antibody, D11Ertd172e antibody, zgc:100969 antibody, MGC83988 antibody, bet5 antibody, mum2 antibody, trafficking protein particle complex 1 antibody, trafficking protein particle complex 1 L homeolog antibody, TRAPPC1 antibody, Trappc1 antibody, trappc1 antibody, trappc1.L antibody
- Background
- This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 17 kDa (MW of target protein)
-