RAP1 antibody (Middle Region)

Catalog No. ABIN632636

Product Details anti-RAP1 Antibody

Target: RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TERF2 IP antibody was raised against the middle region of TERF2 P

Purification: Affinity purified

Immunogen: TERF2 IP antibody was raised using the middle region of TERF2 P corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TERF2IP Blocking Peptide, catalog no. 33R-2322, is also available for use as a blocking control in assays to test for specificity of this TERF2IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TERF0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAP1

Target: RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))

Alternative Name: TERF2IP (TERF2IP Products)

Synonyms: DRIP5 antibody, RAP1 antibody, Rap1 antibody, cRAP1 antibody, TERF2 interacting protein antibody, telomeric repeat binding factor 2, interacting protein antibody, TERF2IP antibody, Terf2ip antibody

Background: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Cell Division Cycle, Telomere Maintenance