DCMP Deaminase (DCTD) (Middle Region) antibody
-
- Target See all DCMP Deaminase (DCTD) Antibodies
- DCMP Deaminase (DCTD)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DCTD antibody was raised against the middle region of DCTD
- Purification
- Affinity purified
- Immunogen
- DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL
- Top Product
- Discover our top product DCTD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DCTD Blocking Peptide, catalog no. 33R-6407, is also available for use as a blocking control in assays to test for specificity of this DCTD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCMP Deaminase (DCTD)
- Alternative Name
- DCTD (DCTD Products)
- Synonyms
- zgc:110226 antibody, DCTD antibody, 6030466N05Rik antibody, Afu2g06240 antibody, MGC81193 antibody, dCMP deaminase antibody, deoxycytidylate deaminase antibody, cell division protein DedD antibody, dCMP deaminase L homeolog antibody, conserved uncharacterised protein antibody, DCTD antibody, dctd antibody, dctD antibody, Dctd antibody, AFUA_2G06240 antibody, ACLA_068070 antibody, LELG_03636 antibody, VIBHAR_RS20285 antibody, LOC5564022 antibody, Ccur_00700 antibody, PAAG_00286 antibody, SPAP_0719 antibody, LOC100285892 antibody, dctd.L antibody, CNB00950 antibody, THAPS_42740 antibody, dCMP deaminase antibody, Thena_0587 antibody, Ccan_15560 antibody
- Target Type
- Viral Protein
- Background
- The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 21 kDa (MW of target protein)
-