Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) antibody
-
- Target See all Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) Antibodies
- Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APBB1 IP antibody was raised against the N terminal Of Apbb1 p
- Purification
- Affinity purified
- Immunogen
- APBB1 IP antibody was raised using the N terminal Of Apbb1 p corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG
- Top Product
- Discover our top product APBB1IP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APBB1IP Blocking Peptide, catalog no. 33R-5496, is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)
- Alternative Name
- APBB1IP (APBB1IP Products)
- Synonyms
- zgc:63968 antibody, apbb1ip antibody, MGC80693 antibody, APBB1IP antibody, INAG1 antibody, PREL1 antibody, RARP1 antibody, RIAM antibody, 9930118P07Rik antibody, Prp48 antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein antibody, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein S homeolog antibody, amyloid beta precursor protein binding family B member 1 interacting protein antibody, amyloid beta A4 precursor protein-binding family B member 1-interacting protein antibody, apbb1ip antibody, apbb1ip.S antibody, APBB1IP antibody, LOC707383 antibody, LOC100439620 antibody, LOC100598478 antibody, Apbb1ip antibody
- Background
- APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.
- Molecular Weight
- 73 kDa (MW of target protein)
-