Hsc70 antibody (N-Term)
-
- Target See all Hsc70 (HSPA8) Antibodies
- Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog, Drosophila melanogaster, C. elegans, Arabidopsis
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Hsc70 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSPA8 antibody was raised against the N terminal of HSPA8
- Purification
- Affinity purified
- Immunogen
- HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
- Top Product
- Discover our top product HSPA8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPA8 Blocking Peptide, catalog no. 33R-9900, is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))
- Alternative Name
- HSPA8 (HSPA8 Products)
- Synonyms
- hsc54 antibody, hsc70 antibody, hsc71 antibody, hsp71 antibody, hsp73 antibody, hspa10 antibody, lap1 antibody, nip71 antibody, HSC54 antibody, HSC70 antibody, HSC71 antibody, HSP71 antibody, HSP73 antibody, HSPA10 antibody, LAP1 antibody, NIP71 antibody, Hsc70 antibody, 2410008N15Rik antibody, Hsc71 antibody, Hsc73 antibody, Hsp73 antibody, Hspa10 antibody, wu:fb01g06 antibody, wu:fi48b06 antibody, heat shock protein family A (Hsp70) member 8 L homeolog antibody, heat shock protein family A (Hsp70) member 8 antibody, heat shock 70kDa protein 8 antibody, heat shock protein 8 antibody, hspa8.L antibody, HSPA8 antibody, Hspa8 antibody, hspa8 antibody
- Background
- HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein.
- Molecular Weight
- 71 kDa (MW of target protein)
-