PSMA5 antibody
-
- Target See all PSMA5 Antibodies
- PSMA5 (Proteasome Subunit alpha 5 (PSMA5))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK
- Top Product
- Discover our top product PSMA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMA5 Blocking Peptide, catalog no. 33R-2904, is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA5 (Proteasome Subunit alpha 5 (PSMA5))
- Alternative Name
- PSMA5 (PSMA5 Products)
- Synonyms
- 154644_at antibody, Alpha-5 antibody, CG10938 antibody, Dmel\\CG10938 antibody, PRCZ antibody, PSA5_DROME antibody, PSMA5 antibody, ProsMA5 antibody, alpha5 antibody, alpha5_dm antibody, prosMA5 antibody, DDBDRAFT_0216562 antibody, DDBDRAFT_0232930 antibody, DDB_0216562 antibody, DDB_0232930 antibody, ZETA antibody, PSC5 antibody, zgc:86851 antibody, Proteasome alpha5 subunit antibody, proteasome subunit alpha type 5, putative antibody, proteasome subunit alpha type 5 antibody, 20S proteasome subunit alpha-5 antibody, proteasome (prosome, macropain) subunit, alpha type 5 antibody, proteasome subunit alpha 5 antibody, proteasome subunit alpha 5 S homeolog antibody, proteasome (prosome, macropain) subunit, alpha type, 5 antibody, Prosalpha5 antibody, PF07_0112 antibody, CNH01360 antibody, cgd5_1820 antibody, PSA5 antibody, psmA5 antibody, NAEGRDRAFT_55551 antibody, LOC100282220 antibody, LOC100283546 antibody, Psma5 antibody, PSMA5 antibody, psma5.S antibody, psma5 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-