SMG8 antibody (Middle Region)
-
- Target See all SMG8 Antibodies
- SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMG8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C17 ORF71 antibody was raised against the middle region of C17 rf71
- Purification
- Affinity purified
- Immunogen
- C17 ORF71 antibody was raised using the middle region of C17 rf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
- Top Product
- Discover our top product SMG8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C17ORF71 Blocking Peptide, catalog no. 33R-3702, is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF71 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))
- Alternative Name
- C17ORF71 (SMG8 Products)
- Synonyms
- C17orf71 antibody, 1200011M11Rik antibody, C19H17orf71 antibody, SMG8, nonsense mediated mRNA decay factor antibody, smg-8 homolog, nonsense mediated mRNA decay factor (C. elegans) antibody, Protein smg-8 antibody, SMG8 antibody, Smg8 antibody, smg-8 antibody
- Background
- The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).
- Molecular Weight
- 110 kDa (MW of target protein)
-