NDFIP2 antibody (Middle Region)

Catalog No. ABIN633059

The Rabbit Polyclonal anti-NDFIP2 antibody is suitable to detect NDFIP2 in samples from Human. It has been validated for WB.

Quick Overview for NDFIP2 antibody (Middle Region) (ABIN633059)

Target: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDFIP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDFIP2 Antibody

Binding Specificity: Middle Region

Specificity: NDFIP2 antibody was raised against the middle region of NDFIP2

Purification: Affinity purified

Immunogen: NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDFIP2 Blocking Peptide, (ABIN5614937), is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDFIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDFIP2

Target: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Alternative Name: NDFIP2

Background: NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity, SARS-CoV-2 Protein Interactome