UGGT1 antibody (Middle Region)
-
- Target See all UGGT1 Antibodies
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UGGT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UGCGL1 antibody was raised against the middle region of µgCGL1
- Purification
- Affinity purified
- Immunogen
- UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
- Top Product
- Discover our top product UGGT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
- Alternative Name
- UGCGL1 (UGGT1 Products)
- Synonyms
- UGCGL1 antibody, ugcgl1 antibody, uggt2 antibody, 0910001L17Rik antibody, A930007H10Rik antibody, AA589501 antibody, AI414429 antibody, AI448372 antibody, C820010P03Rik antibody, GT antibody, UGT1 antibody, Ugcgl1 antibody, Uggt antibody, rUGT1 antibody, HUGT1 antibody, EMS-mutagenized bri1 suppressor 1 antibody, F3I17.13 antibody, F3I17_13 antibody, PRIORITY IN SWEET LIFE 2 antibody, PSL2 antibody, UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE antibody, UGGT antibody, UDP-glucose glycoprotein glucosyltransferase 1 antibody, UDP-glucose glycoprotein glucosyltransferase 1 L homeolog antibody, UDP-glucose:glycoprotein glucosyltransferase 1 antibody, EMS-MUTAGENIZED BRI1 SUPPRESSOR 1 antibody, UGGT1 antibody, uggt1.L antibody, uggt1 antibody, LOC100545947 antibody, Uggt1 antibody, EBS1 antibody
- Background
- UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
- Molecular Weight
- 175 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-