CRP antibody (N-Term)
-
- Target See all CRP Antibodies
- CRP (C-Reactive Protein (CRP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRP antibody was raised against the N terminal of CRP
- Purification
- Affinity purified
- Immunogen
- CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
- Top Product
- Discover our top product CRP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRP Blocking Peptide, catalog no. 33R-5929, is also available for use as a blocking control in assays to test for specificity of this CRP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRP (C-Reactive Protein (CRP))
- Alternative Name
- C-Reactive Protein (CRP Products)
- Synonyms
- PTX1 antibody, crp antibody, AI255847 antibody, Aa1249 antibody, Ab1-341 antibody, Ab2-196 antibody, Ac1-114 antibody, Ac1262 antibody, Ac2-069 antibody, Ba2-693 antibody, APCS antibody, 0610010I23Rik antibody, AW743261 antibody, C77570 antibody, CRP2 antibody, CRP4 antibody, Crp antibody, ESP1 antibody, Hlp antibody, CRP5.1 antibody, zgc:152809 antibody, C-reactive protein antibody, C-reactive protein, pentraxin-related antibody, c-reactive protein, pentraxin-related antibody, cysteine rich protein 2 antibody, CRP antibody, crp antibody, Crp antibody, Crip2 antibody, LOC776376 antibody
- Background
- The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-