SAAL1 antibody (Middle Region)
-
- Target See all SAAL1 Antibodies
- SAAL1 (serum Amyloid A-Like 1 (SAAL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SAAL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SAAL1 antibody was raised against the middle region of SAAL1
- Purification
- Affinity purified
- Immunogen
- SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL
- Top Product
- Discover our top product SAAL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SAAL1 Blocking Peptide, catalog no. 33R-2513, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAAL1 (serum Amyloid A-Like 1 (SAAL1))
- Alternative Name
- SAAL1 (SAAL1 Products)
- Synonyms
- SPACIA1 antibody, 5031425D22Rik antibody, zgc:55505 antibody, serum amyloid A like 1 antibody, serum amyloid A-like 1 antibody, SAAL1 antibody, Saal1 antibody, saal1 antibody
- Background
- The function of SAA protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-