APBB3 antibody

Catalog No. ABIN633150

The Rabbit Polyclonal anti-APBB3 antibody (ABIN633150) specifically detects APBB3 in WB. The antibody is reactive with Human samples.

Quick Overview for APBB3 antibody (ABIN633150)

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APBB3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APBB3 Antibody

Purification: Affinity purified

Immunogen: APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APBB3 Blocking Peptide, (ABIN5612104), is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APBB3

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Alternative Name: APBB3

Background: The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

Molecular Weight: 52 kDa (MW of target protein)