APBB3 antibody
-
- Target See all APBB3 Antibodies
- APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APBB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR
- Top Product
- Discover our top product APBB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APBB3 Blocking Peptide, catalog no. 33R-8950, is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))
- Alternative Name
- APBB3 (APBB3 Products)
- Synonyms
- Fe65l2 antibody, Rirl2 antibody, TR2S antibody, MGC142933 antibody, FE65L2 antibody, SRA antibody, amyloid beta (A4) precursor protein-binding, family B, member 3 antibody, steroid receptor RNA activator 1 antibody, amyloid beta precursor protein binding family B member 3 antibody, Apbb3 antibody, SRA1 antibody, APBB3 antibody, apbb3 antibody
- Background
- The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.
- Molecular Weight
- 52 kDa (MW of target protein)
-