RNP antibody
-
- Target See all RNP (RNPC3) Antibodies
- RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA
- Top Product
- Discover our top product RNPC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNPC3 Blocking Peptide, catalog no. 33R-5006, is also available for use as a blocking control in assays to test for specificity of this RNPC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNPC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))
- Alternative Name
- RNPC3 (RNPC3 Products)
- Synonyms
- rnp antibody, rbm40 antibody, zgc:136847 antibody, RBM40 antibody, RNP antibody, SNRNP65 antibody, 2810441O16Rik antibody, AI447568 antibody, C030014B17Rik antibody, RNA binding region (RNP1, RRM) containing 3 antibody, RNA-binding region (RNP1, RRM) containing 3 antibody, RNPC3 antibody, rnpc3 antibody, Rnpc3 antibody
- Background
- RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3'-stem-loop of m7G-capped U12 snRNA.
- Molecular Weight
- 58 kDa (MW of target protein)
-