DAZL antibody (C-Term)
-
- Target See all DAZL Antibodies
- DAZL (Deleted in Azoospermia-Like (DAZL))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DAZL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DAZL antibody was raised against the C terminal of DAZL
- Purification
- Affinity purified
- Immunogen
- DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR
- Top Product
- Discover our top product DAZL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZL (Deleted in Azoospermia-Like (DAZL))
- Alternative Name
- DAZL (DAZL Products)
- Synonyms
- DAZH antibody, DAZL1 antibody, DAZLA antibody, SPGYLA antibody, DAZL antibody, Xdazl antibody, dazh antibody, dazl1 antibody, dazla antibody, spgyla antibody, dazl-B antibody, dazl-a antibody, Daz-like antibody, Dazh antibody, Dazl1 antibody, Dazla antibody, Tpx-2 antibody, Tpx2 antibody, deleted in azoospermia like antibody, deleted in azoospermia-like antibody, deleted in azoospermia-like L homeolog antibody, DAZL antibody, dazl antibody, Dazl antibody, dazl.L antibody
- Background
- DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.
- Molecular Weight
- 33 kDa (MW of target protein)
-