DAZL antibody (C-Term)

Catalog No. ABIN633244

Product Details anti-DAZL Antibody

Target: DAZL (Deleted in Azoospermia-Like (DAZL))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DAZL antibody was raised against the C terminal of DAZL

Purification: Affinity purified

Immunogen: DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZL

Target: DAZL (Deleted in Azoospermia-Like (DAZL))

Alternative Name: DAZL (DAZL Products)

Synonyms: DAZH antibody, DAZL1 antibody, DAZLA antibody, SPGYLA antibody, DAZL antibody, Xdazl antibody, dazh antibody, dazl1 antibody, dazla antibody, spgyla antibody, dazl-B antibody, dazl-a antibody, Daz-like antibody, Dazh antibody, Dazl1 antibody, Dazla antibody, Tpx-2 antibody, Tpx2 antibody, deleted in azoospermia like antibody, deleted in azoospermia-like antibody, deleted in azoospermia-like L homeolog antibody, DAZL antibody, dazl antibody, Dazl antibody, dazl.L antibody

Background: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.

Molecular Weight: 33 kDa (MW of target protein)